Product Browser

Last updated: 2017/3/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GK polyclonal antibody (A01)

  • Catalog # : H00002710-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GK.
  • Immunogen:
  • GK (NP_000158, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002710-A01
    Western Blot detection against Immunogen (36.34 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • GK polyclonal antibody (A01), Lot # 051214JC01. Western Blot analysis of GK expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2710
  • Gene Name:
  • GK
  • Gene Alias:
  • GK1,GKD
  • Gene Description:
  • glycerol kinase
  • Gene Summary:
  • The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • ATP:glycerol 3-phosphotransferase,glycerokinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook