GK purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GK MaxPab polyclonal antibody. Western Blot analysis of GK expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of GK expression in transfected 293T cell line (H00002710-T01) by GK MaxPab polyclonal antibody.
Lane 1: GK transfected lysate(57.64 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to GK on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GK protein.
Immunogen
GK (NP_000158.1, 1 a.a. ~ 524 a.a) full-length human protein.
Sequence
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GK MaxPab polyclonal antibody. Western Blot analysis of GK expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of GK expression in transfected 293T cell line (H00002710-T01) by GK MaxPab polyclonal antibody.
Lane 1: GK transfected lysate(57.64 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to GK on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] -
Gene Info — GK
Entrez GeneID
2710GeneBank Accession#
NM_000167.3Protein Accession#
NP_000158.1Gene Name
GK
Gene Alias
GK1, GKD
Gene Description
glycerol kinase
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
ATP:glycerol 3-phosphotransferase|glycerokinase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com