BLOC1S1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BLOC1S1 partial ORF ( NP_001478, 31 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BLOC1S1
Entrez GeneID
2647GeneBank Accession#
NM_001487Protein Accession#
NP_001478Gene Name
BLOC1S1
Gene Alias
BLOS1, FLJ39337, FLJ97089, GCN5L1, MGC87455, MICoA, RT14
Gene Description
biogenesis of lysosomal organelles complex-1, subunit 1
Omim ID
601444Gene Ontology
HyperlinkGene Summary
BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM
Other Designations
BLOC subunit 1|BLOC-1 subunit 1|GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 1|GCN5 general control of amino-acid synthesis 5-like 1|MTA1-interacting coactivator|biogenesis of lysosome-related organelles complex-1, subunit 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com