GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GCHFR protein.
Immunogen
GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) full-length human protein.
Sequence
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GCHFR expression in transfected 293T cell line (H00002644-T02) by GCHFR MaxPab polyclonal antibody.
Lane 1: GCHFR transfected lysate(9.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GCHFR
Entrez GeneID
2644GeneBank Accession#
NM_005258Protein Accession#
NP_005249.1Gene Name
GCHFR
Gene Alias
GFRP, HsT16933, MGC138467, MGC138469, P35
Gene Description
GTP cyclohydrolase I feedback regulator
Omim ID
602437Gene Ontology
HyperlinkGene Summary
GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq
Other Designations
GTP cyclohydrolase I feedback regulatory protein
-
Interactome
-
Disease
-
Publication Reference
-
The protein partners of GTP cyclohydrolase I in rat organs.
Du J, Teng RJ, Lawrence M, Guan T, Xu H, Ge Y, Shi Y.
PLoS One 2012 Mar; 7(3):e33991.
Application:WB, Human, Rat, HEK 293 cells, Rat liver.
-
The protein partners of GTP cyclohydrolase I in rat organs.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com