GALE purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GALE MaxPab polyclonal antibody. Western Blot analysis of GALE expression in human colon.
Western Blot (Transfected lysate)
Western Blot analysis of GALE expression in transfected 293T cell line (H00002582-T01) by GALE MaxPab polyclonal antibody.
Lane 1: GALE transfected lysate(38.28 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GALE protein.
Immunogen
GALE (NP_000394.2, 1 a.a. ~ 348 a.a) full-length human protein.
Sequence
MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GALE MaxPab polyclonal antibody. Western Blot analysis of GALE expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of GALE expression in transfected 293T cell line (H00002582-T01) by GALE MaxPab polyclonal antibody.
Lane 1: GALE transfected lysate(38.28 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GALE
Entrez GeneID
2582GeneBank Accession#
NM_000403.3Protein Accession#
NP_000394.2Gene Name
GALE
Gene Alias
FLJ95174, FLJ97302, SDR1E1
Gene Description
UDP-galactose-4-epimerase
Gene Ontology
HyperlinkGene Summary
This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). Multiple alternatively spliced transcripts encoding the same protein have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000002991|OTTHUMP00000044857|UDP galactose-4'-epimerase|galactose-4-epimerase, UDP-|galactowaldenase|short chain dehydrogenase/reductase family 1E, member 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com