G1P3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human G1P3 full-length ORF ( AAH11601, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSCVVIGNIGALMGYATHKYLDSEEDEE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
40.04
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IFI6
Entrez GeneID
2537GeneBank Accession#
BC011601Protein Accession#
AAH11601Gene Name
IFI6
Gene Alias
6-16, FAM14C, G1P3, IFI-6-16, IFI616
Gene Description
interferon, alpha-inducible protein 6
Omim ID
147572Gene Ontology
HyperlinkGene Summary
This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described. [provided by RefSeq
Other Designations
OTTHUMP00000003605|OTTHUMP00000003606|OTTHUMP00000003607|interferon, alpha-inducible protein clone IFI-6-16
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com