Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

G1P3 (Human) Recombinant Protein (P01)

  • Catalog # : H00002537-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human G1P3 full-length ORF ( AAH11601, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSCVVIGNIGALMGYATHKYLDSEEDEE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.04
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002537-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2537
  • Gene Name:
  • IFI6
  • Gene Alias:
  • 6-16,FAM14C,G1P3,IFI-6-16,IFI616
  • Gene Description:
  • interferon, alpha-inducible protein 6
  • Gene Summary:
  • This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000003605,OTTHUMP00000003606,OTTHUMP00000003607,interferon, alpha-inducible protein clone IFI-6-16
  • RSS
  • YouTube
  • Linkedin
  • Facebook