DARC purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human DARC protein.
Immunogen
DARC (NP_002027.2, 1 a.a. ~ 336 a.a) full-length human protein.
Sequence
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (60); Rat (60)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DARC MaxPab rabbit polyclonal antibody. Western Blot analysis of DARC expression in mouse stomach.Western Blot (Cell lysate)
DARC MaxPab rabbit polyclonal antibody. Western Blot analysis of DARC expression in IMR-32.Western Blot (Transfected lysate)
Western Blot analysis of DARC expression in transfected 293T cell line (H00002532-T02) by DARC MaxPab polyclonal antibody.
Lane 1: DARC transfected lysate(35.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DARC
Entrez GeneID
2532GeneBank Accession#
NM_002036Protein Accession#
NP_002027.2Gene Name
DARC
Gene Alias
CCBP1, CD234, Dfy, FY, GPD, GpFy, WBCQ1
Gene Description
Duffy blood group, chemokine receptor
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Duffy antigen/chemokine receptor|Duffy blood group antigen|Fy glycoprotein|OTTHUMP00000035293|OTTHUMP00000060081|glycoprotein D
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com