Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPHA1 polyclonal antibody (A01)

  • Catalog # : H00002041-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EPHA1.
  • Immunogen:
  • EPHA1 (NP_005223, 394 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002041-A01
    Western Blot detection against Immunogen (37.88 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2041
  • Gene Name:
  • EPHA1
  • Gene Alias:
  • EPH,EPHT,EPHT1,MGC163163
  • Gene Description:
  • EPH receptor A1
  • Gene Summary:
  • This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene is expressed in some human cancer cell lines and has been implicated in carcinogenesis. [provided by RefSeq
  • Other Designations:
  • eph tyrosine kinase 1,ephrin receptor EphA1,ephrin type-A receptor 1,erythropoietin-producing hepatoma amplified sequence,oncogene EPH,soluble EPHA1 variant 1,soluble EPHA1 variant 2,tyrosine-protein kinase receptor EPH
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook