EN1 monoclonal antibody (M04), clone 3H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant EN1.
Immunogen
EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE*
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EN1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EN1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — EN1
Entrez GeneID
2019GeneBank Accession#
NM_001426Protein Accession#
NP_001417Gene Name
EN1
Gene Alias
-
Gene Description
engrailed homeobox 1
Omim ID
131290Gene Ontology
HyperlinkGene Summary
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq
Other Designations
OTTHUMP00000162091|engrailed homolog 1
-
Interactomes
-
Diseases
-
Publication Reference
-
Specification of dopaminergic subsets involves interplay of En1 and Pitx3.
Veenvliet JV, Dos Santos MT, Kouwenhoven WM, von Oerthel L, Lim JL, van der Linden AJ, Koerkamp MJ, Holstege FC, Smidt MP.
Development 2013 Aug; 140(16):3373.
Application:IP, Mouse, MN9D-N13-cells.
-
Specification of dopaminergic subsets involves interplay of En1 and Pitx3.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com