MARK2 monoclonal antibody (M01), clone 3B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MARK2.
Immunogen
MARK2 (AAH08771, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MARK2 monoclonal antibody (M01), clone 3B12. Western Blot analysis of MARK2 expression in PC-12.Western Blot (Cell lysate)
MARK2 monoclonal antibody (M01), clone 3B12. Western Blot analysis of MARK2 expression in A-431.Western Blot (Cell lysate)
MARK2 monoclonal antibody (M01), clone 3B12. Western Blot analysis of MARK2 expression in NIH/3T3.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MARK2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — MARK2
Entrez GeneID
2011GeneBank Accession#
BC008771Protein Accession#
AAH08771Gene Name
MARK2
Gene Alias
EMK1, MGC99619, PAR-1, Par1b
Gene Description
MAP/microtubule affinity-regulating kinase 2
Omim ID
600526Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
ELKL motif kinase 1|Ser/Thr protein kinase PAR-1B|protein-serine/threonine kinase|serine/threonine kinase
-
Interactome
-
Disease
-
Publication Reference
-
Pancreatic LKB1 deletion leads to acinar polarity defects and cystic neoplasms.
Hezel AF, Gurumurthy S, Granot Z, Swisa A, Chu GC, Bailey G, Dor Y, Bardeesy N, Depinho RA.
Molecular and Cellular Biology 2008 Jan; 28(7):2414.
-
Pancreatic LKB1 deletion leads to acinar polarity defects and cystic neoplasms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com