EEF1D (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EEF1D partial ORF ( NP_115754, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.75
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EEF1D
Entrez GeneID
1936GeneBank Accession#
NM_032378Protein Accession#
NP_115754Gene Name
EEF1D
Gene Alias
EF-1D, EF1D, FLJ20897, FP1047
Gene Description
eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein)
Omim ID
130592Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit functions as guanine nucleotide exchange factor. It is reported that this subunit interacts with HIV-1 Tat, and thus it represses the translation of host-cell, but not HIV-1, mRNAs. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq
Other Designations
antigen NY-CO-4|eukaryotic translation elongation factor 1 delta|guanine nucleotide exchange protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com