E2F1 monoclonal antibody (M01), clone 2E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged E2F1 is approximately 0.03ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDK7 and E2F1. Huh7 cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MYBL2 and E2F1. Mahlavu cells were stained with anti-MYBL2 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDK7 and E2F1. HeLa cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant E2F1.
Immunogen
E2F1 (NP_005216.1, 348 a.a. ~ 437 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged E2F1 is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDK7 and E2F1. Huh7 cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MYBL2 and E2F1. Mahlavu cells were stained with anti-MYBL2 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDK7 and E2F1. HeLa cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — E2F1
Entrez GeneID
1869GeneBank Accession#
NM_005225Protein Accession#
NP_005216.1Gene Name
E2F1
Gene Alias
E2F-1, RBAP1, RBBP3, RBP3
Gene Description
E2F transcription factor 1
Omim ID
189971Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis. [provided by RefSeq
Other Designations
OTTHUMP00000030661|retinoblastoma-associated protein 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com