DLX4 monoclonal antibody (M01), clone 1F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody (M01), clone 1F11.
Lane 1: DLX4 transfected lysate(26 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of DLX4 transfected lysate using anti-DLX4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DLX4 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DLX4 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of DLX4 over-expressed 293 cell line, cotransfected with DLX4 Validated Chimera RNAi ( Cat # H00001748-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DLX4 monoclonal antibody (M01), clone 1F11 (Cat # H00001748-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DLX4.
Immunogen
DLX4 (AAH16145, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody (M01), clone 1F11.
Lane 1: DLX4 transfected lysate(26 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of DLX4 transfected lysate using anti-DLX4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DLX4 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DLX4 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of DLX4 over-expressed 293 cell line, cotransfected with DLX4 Validated Chimera RNAi ( Cat # H00001748-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DLX4 monoclonal antibody (M01), clone 1F11 (Cat # H00001748-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — DLX4
Entrez GeneID
1748GeneBank Accession#
BC016145Protein Accession#
AAH16145Gene Name
DLX4
Gene Alias
BP1, DLX7, DLX8, DLX9
Gene Description
distal-less homeobox 4
Omim ID
601911Gene Ontology
HyperlinkGene Summary
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function. [provided by RefSeq
Other Designations
beta protein 1|distal-less homeo box 7|distal-less homeo box 9
-
Interactome
-
Disease
-
Publication Reference
-
DLX4 is associated with orofacial clefting and abnormal jaw development.
Wu D, Mandal S, Choi A, Anderson A, Prochazkova M, Perry H, Gil-Da-Silva-Lopes VL, Lao R, Wan E, Tang PL, Kwok PY, Klein O, Zhuan B, Slavotinek AM.
Human Molecular Genetics 2015 Aug; 24(15):4340.
Application：IF, WB-Tr, Human, HeLa cells.
-
Homeodomain protein DLX4 counteracts key transcriptional control mechanisms of the TGF-?] cytostatic program and blocks the antiproliferative effect of TGF-?].
Trinh BQ, Barengo N, Naora H.
Oncogene 2011 Jun; 30(24):2718.
Application：WB, Human, MDA-MB-468, HepG2 cells.
-
A homeobox gene related to Drosophila distal-less promotes ovarian tumorigenicity by inducing expression of vascular endothelial growth factor and fibroblast growth factor-2.
Hara F, Samuel S, Liu J, Rosen D, Langley RR, Naora H.
The American Journal of Pathology 2007 May; 170(5):1594.
Application：WB, Human, Human epithelial ovarian tumors, A2780 DLX4-2, ES-2 DLX4-10 cells.
-
DLX4 is associated with orofacial clefting and abnormal jaw development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com