Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CETN1 (Human) Recombinant Protein (P01)

  • Catalog # : H00001068-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CETN1 full-length ORF ( NP_004057.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 46
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001068-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1068
  • Gene Name:
  • CETN1
  • Gene Alias:
  • CEN1,CETN
  • Gene Description:
  • centrin, EF-hand protein, 1
  • Gene Summary:
  • The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq
  • Other Designations:
  • Centrin-1,EF-hand protein,calcium binding protein,centrin 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook