CDH17 monoclonal antibody (M01), clone 1H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDH17.
Immunogen
CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (83)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CDH17 monoclonal antibody (M01), clone 1H3. Western Blot analysis of CDH17 expression in human intestinal wall.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDH17 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDH17 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CDH17
Entrez GeneID
1015GeneBank Accession#
NM_004063Protein Accession#
NP_004054Gene Name
CDH17
Gene Alias
CDH16, FLJ26931, HPT-1, HPT1, MGC138218, MGC142024
Gene Description
cadherin 17, LI cadherin (liver-intestine)
Omim ID
603017Gene Ontology
HyperlinkGene Summary
This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
HPT-1 cadherin|LI cadherin|cadherin 17|cadherin-16|human intestinal peptide-associated transporter HPT-1|human peptide transporter 1|liver-intestine cadherin
-
Interactome
-
Disease
-
Publication Reference
-
Comparison of cadherin-17 expression between primary colorectal adenocarcinomas and their corresponding metastases: the possibility of a diagnostic marker for detecting the primary site of metastatic tumour.
Park JH, Seol JA, Choi HJ, Roh YH, Choi PJ, Lee KE, Roh MS.
Histopathology 2011 Jan; 58(2):315.
Application:IHC, Human, Human colorectal adenocarcinoma.
-
Cadherin-17 is a useful diagnostic marker for adenocarcinomas of the digestive system.
Su MC, Yuan RH, Lin CY, Jeng YM.
Modern Pathology 2008 Jun; 21(11):1379.
Application:IHC-P, WB-Ti, Human, Normal and tumor tissues, including kidney, liver, colon, small intestine, stomach, spleen, thyroid, pancreas, placenta .
-
Comparison of cadherin-17 expression between primary colorectal adenocarcinomas and their corresponding metastases: the possibility of a diagnostic marker for detecting the primary site of metastatic tumour.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com