TNFSF8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TNFSF8 expression in transfected 293T cell line (H00000944-T01) by TNFSF8 MaxPab polyclonal antibody.
Lane 1: TNFSF8 transfected lysate(25.74 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TNFSF8 protein.
Immunogen
TNFSF8 (NP_001235.1, 1 a.a. ~ 234 a.a) full-length human protein.
Sequence
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TNFSF8 expression in transfected 293T cell line (H00000944-T01) by TNFSF8 MaxPab polyclonal antibody.
Lane 1: TNFSF8 transfected lysate(25.74 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TNFSF8
Entrez GeneID
944GeneBank Accession#
NM_001244Protein Accession#
NP_001235.1Gene Name
TNFSF8
Gene Alias
CD153, CD30L, CD30LG, MGC138144
Gene Description
tumor necrosis factor (ligand) superfamily, member 8
Omim ID
603875Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. [provided by RefSeq
Other Designations
CD153 antigen|CD30 antigen ligand|CD30 ligand|OTTHUMP00000022762
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com