Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAV1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000857-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CAV1 protein.
  • Immunogen:
  • CAV1 (AAH82246.1, 1 a.a. ~ 178 a.a) full-length human protein.
  • Sequence:
  • MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CAV1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CAV1 expression in human colon.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CAV1 expression in transfected 293T cell line (H00000857-T03) by CAV1 MaxPab polyclonal antibody.

    Lane 1: CAV1 transfected lysate(20.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 857
  • Gene Name:
  • CAV1
  • Gene Alias:
  • BSCL3,CAV,CGL3,MSTP085,VIP21
  • Gene Description:
  • caveolin 1, caveolae protein, 22kDa
  • Gene Summary:
  • The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025031,caveolae protein, 22-kD,caveolin 1,caveolin 1 caveolae protein, 22kD,caveolin 1, alpha isoform,caveolin 1, beta isoform,caveolin-1 beta isoform protein,cell growth-inhibiting protein 32
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook