CASQ2 monoclonal antibody (M01), clone 1B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CASQ2 expression in transfected 293T cell line by CASQ2 monoclonal antibody (M01), clone 1B6.
Lane 1: CASQ2 transfected lysate(46.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CASQ2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (67.54 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CASQ2.
Immunogen
CASQ2 (AAH22288, 20 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (67.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CASQ2 expression in transfected 293T cell line by CASQ2 monoclonal antibody (M01), clone 1B6.
Lane 1: CASQ2 transfected lysate(46.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CASQ2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CASQ2
Entrez GeneID
845GeneBank Accession#
BC022288Protein Accession#
AAH22288Gene Name
CASQ2
Gene Alias
FLJ26321, FLJ93514, PDIB2
Gene Description
calsequestrin 2 (cardiac muscle)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest. [provided by RefSeq
Other Designations
OTTHUMP00000013749|calsequestrin 2, fast-twitch, cardiac muscle|cardiac calsequestrin 2
-
Interactome
-
Disease
-
Publication Reference
-
A novel mouse model of X-linked cardiac hypertrophy.
Leatherbury L, Yu Q, Chatterjee B, Walker DL, Yu Z, Tian X, Lo CW.
American Journal of Physiology. Heart and Circulatory Physiology 2008 Apr; 294(6):H2701.
-
A novel mouse model of X-linked cardiac hypertrophy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com