Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAPN1 polyclonal antibody (A01)

  • Catalog # : H00000823-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CAPN1.
  • Immunogen:
  • CAPN1 (AAH08751, 610 a.a. ~ 714 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000823-A01
    Western Blot detection against Immunogen (37.55 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAPN1 polyclonal antibody (A01), Lot # 050913JC01 Western Blot analysis of CAPN1 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 823
  • Gene Name:
  • CAPN1
  • Gene Alias:
  • CANP,CANP1,CANPL1,muCANP,muCL
  • Gene Description:
  • calpain 1, (mu/I) large subunit
  • Gene Summary:
  • The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. [provided by RefSeq
  • Other Designations:
  • calcium-activated neutral proteinase,calpain 1, large subunit,calpain, large polypeptide L1,cell proliferation-inducing protein 30
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook