CA12 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CA12 MaxPab polyclonal antibody. Western Blot analysis of CA12 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of CA12 expression in transfected 293T cell line (H00000771-T01) by CA12 MaxPab polyclonal antibody.
Lane 1: CA12 transfected lysate(38.94 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CA12 protein.
Immunogen
CA12 (NP_001209.1, 1 a.a. ~ 354 a.a) full-length human protein.
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CA12 MaxPab polyclonal antibody. Western Blot analysis of CA12 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of CA12 expression in transfected 293T cell line (H00000771-T01) by CA12 MaxPab polyclonal antibody.
Lane 1: CA12 transfected lysate(38.94 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CA12
Entrez GeneID
771GeneBank Accession#
NM_001218.3Protein Accession#
NP_001209.1Gene Name
CA12
Gene Alias
CAXII, FLJ20151, HsT18816
Gene Description
carbonic anhydrase XII
Omim ID
603263Gene Ontology
HyperlinkGene Summary
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
carbonic dehydratase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com