ZFP36L1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ZFP36L1 partial ORF ( NP_004917, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.62
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ZFP36L1
Entrez GeneID
677GeneBank Accession#
NM_004926Protein Accession#
NP_004917Gene Name
ZFP36L1
Gene Alias
BRF1, Berg36, ERF-1, ERF1, RNF162B, TIS11B, cMG1
Gene Description
zinc finger protein 36, C3H type-like 1
Omim ID
601064Gene Ontology
HyperlinkGene Summary
This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. [provided by RefSeq
Other Designations
EGF-response factor 1|butyrate response factor 1|early response factor Berg36|zinc finger protein, C3H type, 36-like 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com