CXCR5 monoclonal antibody (M01), clone 2C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BLR1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (32.16 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CXCR5.
Immunogen
CXCR5 (NP_001707, 1 a.a. ~ 55 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.16 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BLR1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CXCR5
Entrez GeneID
643GeneBank Accession#
NM_001716Protein Accession#
NP_001707Gene Name
CXCR5
Gene Alias
BLR1, CD185, MDR15, MGC117347
Gene Description
chemokine (C-X-C motif) receptor 5
Omim ID
601613Gene Ontology
HyperlinkGene Summary
This gene was identified as a gene specifically expressed in Burkitt's lymphoma and lymphatic tissues. The protein encoded by this gene is predicted to be a seven transmembrane G protein- coupled receptor and belongs to the CXC chemokine receptor family. BLC, a B-lymphocyte chemoattractant, was identified to be a specific ligand for this receptor. Studies of this gene and its mouse conterpart strongly suggest the essential function of this gene in B cell migration and localization within specific anatomic compartments, such as follicles in lymph nodes as well as in spleen. Two alternatively spliced variants of this gene exist. [provided by RefSeq
Other Designations
Burkitt lymphoma receptor 1|Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif) receptor 5)|Burkitt lymphoma receptor 1, GTP-binding protein|C-X-C chemokine receptor type 5|monocyte-derived receptor 15
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com