ASL purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ASL MaxPab rabbit polyclonal antibody. Western Blot analysis of ASL expression in human liver.
Western Blot (Tissue lysate)
ASL MaxPab rabbit polyclonal antibody. Western Blot analysis of ASL expression in mouse kidney.
Western Blot (Transfected lysate)
Western Blot analysis of ASL expression in transfected 293T cell line (H00000435-T01) by ASL MaxPab polyclonal antibody.
Lane 1: ASL transfected lysate(51.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ASL protein.
Immunogen
ASL (NP_000039.2, 1 a.a. ~ 464 a.a) full-length human protein.
Sequence
MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ASL MaxPab rabbit polyclonal antibody. Western Blot analysis of ASL expression in human liver.Western Blot (Tissue lysate)
ASL MaxPab rabbit polyclonal antibody. Western Blot analysis of ASL expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of ASL expression in transfected 293T cell line (H00000435-T01) by ASL MaxPab polyclonal antibody.
Lane 1: ASL transfected lysate(51.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ASL
Entrez GeneID
435GeneBank Accession#
NM_000048.3Protein Accession#
NP_000039.2Gene Name
ASL
Gene Alias
ASAL
Gene Description
argininosuccinate lyase
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000024494|OTTHUMP00000159903|argininosuccinase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com