ACRV1 MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human ACRV1 protein.
Immunogen
ACRV1 (NP_001603, 1 a.a. ~ 265 a.a) full-length human protein.
Sequence
MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (62); Rat (61)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ACRV1 expression in transfected 293T cell line (H00000056-T02) by ACRV1 MaxPab polyclonal antibody.
Lane 1: ACRV1 transfected lysate(29.15 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ACRV1
Entrez GeneID
56GeneBank Accession#
NM_001612Protein Accession#
NP_001603Gene Name
ACRV1
Gene Alias
D11S4365, SP-10, SPACA2
Gene Description
acrosomal vesicle protein 1
Omim ID
102525Gene Ontology
HyperlinkGene Summary
This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its alternative splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. [provided by RefSeq
Other Designations
sperm protein 10
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com