Product Browser
 
  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

ADM polyclonal antibody   

  • Catalog # : PAB4972
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 150 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of ADM.
  • Immunogen:
  • A synthetic peptide (conjugated with KLH) corresponding to human ADM.
  • Sequence:
  • YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Quality Control Testing:
  • Antibody Reactive Against synthetic peptide.
  • Recommend Usage:
  • The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains thimerosal: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunoprecipitation
  • Enzyme Immunoassay
  • Application Image
  • Immunoprecipitation
  • Enzyme Immunoassay
  • Gene Information
  • Entrez GeneID:
  • 133
  • Gene Name:
  • ADM
  • Gene Alias:
  • AM
  • Gene Description:
  • adrenomedullin
  • Gene Summary:
  • Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element. [provided by RefSeq
  • Other Designations:
  • preproadrenomedullin
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!