Product Browser

Last updated: 2014/7/28

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Vegfa (Rat) Recombinant ProteinBioActive

  • Catalog # : P4853
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Vegfa recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 38.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent induced proliferation of HUVECs. The expected ED50 for this effect is 5.9-8.9 ng/mL.
  • Storage Buffer:
  • Lyophilized from 10 mM NaP, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Serial dilutions of rat Vegfa, starting at 250 ng/mL, were added to HUVECs. After 87 hours, cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Vegfa
  • Gene Alias:
  • VEGF164,Vegf
  • Gene Description:
  • vascular endothelial growth factor A
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook