SGOL1 monoclonal antibody (M01), clone 3C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SGOL1.
Immunogen
SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SGOL1 monoclonal antibody (M01), clone 3C11. Western Blot analysis of SGOL1 expression in HeLa.Western Blot (Cell lysate)
SGOL1 monoclonal antibody (M01), clone 3C11. Western Blot analysis of SGOL1 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody (M01), clone 3C11.
Lane 1: SGOL1 transfected lysate(33.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGOL1 MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — SGOL1
Entrez GeneID
151648GeneBank Accession#
BC017867Protein Accession#
AAH17867Gene Name
SGOL1
Gene Alias
NY-BR-85, SGO, Sgo1
Gene Description
shugoshin-like 1 (S. pombe)
Omim ID
609168Gene Ontology
HyperlinkOther Designations
shugoshin 1AB protein|shugoshin 1CD protein|shugoshin 1EF protein|shugoshin 1GH protein|shugoshin 1KL protein|shugoshin-like 1
-
Interactome
-
Disease
-
Publication Reference
-
Histone H3K79 methylation by DOT1L promotes Aurora B localization at centromeres in mitosis.
Dan Yang, Yanji He, Renyan Li, Zhenting Huang, Yong Zhou, Yingxu Shi, Zhongliang Deng, Jingxian Wu, Yanfei Gao.
Cell Reports 2023 Aug; 42(8):112885.
Application:IF, Human, HeLa cell.
-
Bub1 and CENP-U redundantly recruit Plk1 to stabilize kinetochore-microtubule attachments and ensure accurate chromosome segregation.
Qinfu Chen, Miao Zhang, Xuan Pan, Xueying Yuan, Linli Zhou, Lu Yan, Ling-Hui Zeng, Junfen Xu, Bing Yang, Long Zhang, Jun Huang, Weiguo Lu, Tatsuo Fukagawa, Fangwei Wang, Haiyan Yan.
Cell Reports 2021 Sep; 36(12):109740.
Application:IF, Human, HeLa cells.
-
Centromere-localized Aurora B kinase is required for the fidelity of chromosome segregation.
Liang C, Zhang Z, Chen Q, Yan H, Zhang M, Zhou L, Xu J, Lu W, Wang F.
The Journal of Cell Biology 2020 Feb; 219(2):e201907092.
Application:IF, WB-Tr, Human, HeLa cells.
-
Histone H2A phosphorylation recruits topoisomerase IIα to centromeres to safeguard genomic stability.
Zhang M, Liang C, Chen Q, Yan H, Xu J, Zhao H, Yuan X, Liu J, Lin S, Lu W, Wang F.
The EMBO Journal 2019 Nov; e101863.
Application:IF, WB-Tr, Human, HeLa, Sgo1-K492A cells.
-
Division of labour between PP2A-B56 isoforms at the centromere and kinetochore.
Vallardi G, Allan LA, Crozier L, Saurin AT.
Elife 2019 Mar; 8:e42619.
Application:WB, Human, HeLa cells.
-
A positive feedback mechanism ensures proper assembly of the functional inner centromere during mitosis in human cells.
Liang C, Zhang Z, Chen Q, Yan H, Zhang M, Xiang X, Yi Q, Pan X, Cheng H, Wang F.
The Journal of Biological Chemistry 2019 Feb; 294(5):1437.
Application:IF, WB, Human, HeLa cells.
-
Dataset of Sgo1 expression in cardiac, gastrointestinal, hepatic and neuronal tissue in mouse.
Song AT, Galli A, Leclerc S, Nattel S, Mandato C, Andelfinger G.
Data in Brief 2017 Jul; 13:731.
Application:IF, IHC-P, Mouse, Mouse embryo.
-
Chromosome segregation regulation in human zygotes: altered mitotic histone phosphorylation dynamics underlying centromeric targeting of the chromosomal passenger complex.
van de Werken C, Avo Santos M, Laven JS, Eleveld C, Fauser BC, Lens SM, Baart EB.
Human Reproduction 2015 Oct; 30(10):2275.
Application:IF, Human, Embryos.
-
Negative feedback at kinetochores underlies a responsive spindle checkpoint signal.
Nijenhuis W, Vallardi G, Teixeira A, Kops GJ, Saurin AT.
Nature Cell Biology 2014 Dec; 16(12):1257.
Application:WB, Human, HeLa cells.
-
Dynamics of cohesin proteins REC8, STAG3, SMC1?] and SMC3 are consistent with a role in sister chromatid cohesion during meiosis in human oocytes.
Garcia-Cruz R, Brieno MA, Roig I, Grossmann M, Velilla E, Pujol A, Cabero L, Pessarrodona A, Barbero JL, Garcia Caldes M.
Human Reproduction (Oxford, England) 2010 Sep; 25(9):2316.
Application:IF, Human, Human oocytes.
-
Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
Nozawa RS, Nagao K, Masuda HT, Iwasaki O, Hirota T, Nozaki N, Kimura H, Obuse C.
Nature Cell Biology 2010 Jul; 12(7):719.
Application:IF, Human, HeLa cells.
-
A B56gamma mutation in lung cancer disrupts the p53-dependent tumor-suppressor function of protein phosphatase 2A.
Shouse GP, Nobumori Y, Liu X.
Oncogene 2010 Jul; 29(27):3933.
Application:WB, Human, U2OS cells.
-
Centromere DNA decatenation depends on cohesin removal and is required for mammalian cell division.
Wang LH, Mayer B, Stemmann O, Nigg EA.
Journal of Cell Science 2010 Mar; 123(Pt 5):806.
Application:IF, Human, HeLa cells.
-
Visualizing histone modifications in living cells: spatiotemporal dynamics of H3 phosphorylation during interphase.
Hayashi-Takanaka Y, Yamagata K, Nozaki N, Kimura H.
Journal of Cellular Biology 2009 Dec; 187(6):781.
Application:IF, Human, G2 cells.
-
Astrin is required for the maintenance of sister chromatid cohesion and centrosome integrity.
Thein KH, Kleylein-Sohn J, Nigg EA, Gruneberg U.
Journal of Cellular Biology 2007 Jul; 178(3):345.
Application:Func, Human, HeLa cells.
-
Phosphorylation of human Sgo1 by NEK2A is essential for chromosome congression in mitosis.
Fu G, Ding X, Yuan K, Aikhionbare F, Yao J, Cai X, Jiang K, Yao X.
Cell Research 2007 Jul; 17(7):608.
Application:IF, WB-Tr, Human, HeLa cells.
-
Regulation of mitotic chromosome cohesion by Haspin and Aurora B.
Dai J, Sullivan BA, Higgins JM.
Developmental cell 2006 Nov; 11(5):741.
Application:IF, Human, HeLa cells.
-
Histone H3K79 methylation by DOT1L promotes Aurora B localization at centromeres in mitosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com