- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25895)
- MaxPab® Ab (16205)
- Monoclonal Ab (21428)
- Polyclonal Ab (27861)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7710)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2004)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2136)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (18054)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Plasma/Serum > SGOL1 monoclonal antibody (M01), clone 3C11
SGOL1 monoclonal antibody (M01), clone 3C11
- Catalog # : H00151648-M01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a full length recombinant SGOL1.
- Immunogen:
- SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG2a Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.86 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Dynamics of cohesin proteins REC8, STAG3, SMC1?] and SMC3 are consistent with a role in sister chromatid cohesion during meiosis in human oocytes.
Garcia-Cruz R, Brieno MA, Roig I, Grossmann M, Velilla E, Pujol A, Cabero L, Pessarrodona A, Barbero JL, Garcia Caldes M.Hum Reprod. 2010 Sep;25(9):2316-27. Epub 2010 Jul 15.
- 2.
- Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
Nozawa RS, Nagao K, Masuda HT, Iwasaki O, Hirota T, Nozaki N, Kimura H, Obuse C.Nat Cell Biol. 2010 Jul;12(7):719-27. Epub 2010 Jun 20.
- 3.
- A B56?^ mutation in lung cancer disrupts the p53-dependent tumor-suppressor function of protein phosphatase 2A.
Shouse GP, Nobumori Y, Liu X.Oncogene. 2010 May 17. [Epub ahead of print]
- 4.
- Centromere DNA decatenation depends on cohesin removal and is required for mammalian cell division.
Wang LH, Mayer B, Stemmann O, Nigg EA.J Cell Sci. 2010 Mar 1;123(Pt 5):806-13. Epub 2010 Feb 9.
- 5.
- Visualizing histone modifications in living cells: spatiotemporal dynamics of H3 phosphorylation during interphase.
Hayashi-Takanaka Y, Yamagata K, Nozaki N, Kimura H.J Cell Biol. 2009 Dec 14;187(6):781-90.
- 6.
- Astrin is required for the maintenance of sister chromatid cohesion and centrosome integrity.
Thein KH, Kleylein-Sohn J, Nigg EA, Gruneberg U.J Cell Biol. 2007 Jul 30;178(3):345-54.
- 7.
- Phosphorylation of human Sgo1 by NEK2A is essential for chromosome congression in mitosis.
Fu G, Ding X, Yuan K, Aikhionbare F, Yao J, Cai X, Jiang K, Yao X.Cell Res. 2007 Jul;17(7):608-18.
- 8.
- Regulation of mitotic chromosome cohesion by Haspin and Aurora B.
Dai J, Sullivan BA, Higgins JM.Dev Cell. 2006 Nov;11(5):741-50.
- Applications
- Western Blot (Transfected lysate)
- Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody (M01), clone 3C11.
Lane 1: SGOL1 transfected lysate(33.5 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Immunoprecipitation
- Immunoprecipitation of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SGOL1 MaxPab rabbit polyclonal antibody.
- Protocol Download
- Entrez GeneID:
- 151648
- GeneBank Accession#:
- BC017867
- Protein Accession#:
- AAH17867
- Gene Name:
- SGOL1
- Gene Alias:
- NY-BR-85,SGO,Sgo1
- Gene Description:
- shugoshin-like 1 (S. pombe)
- Omim ID:
- 609168
- Gene Ontology:
- Hyperlink
- Other Designations:
- shugoshin 1AB protein,shugoshin 1CD protein,shugoshin 1EF protein,shugoshin 1GH protein,shugoshin 1KL protein,shugoshin-like 1
- Related Disease
