SGOL1 monoclonal antibody (M01J), clone 3C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant SGOL1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
Host
Mouse
Reactivity
Human, Rat
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SGOL1 monoclonal antibody (M01J), clone 3C11. Western Blot analysis of SGOL1 expression in HeLa.Western Blot (Cell lysate)
SGOL1 monoclonal antibody (M01J), clone 3C11. Western Blot analysis of SGOL1 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody (M01J), clone 3C11.
Lane 1: SGOL1 transfected lysate (Predicted MW: 33.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGOL1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SGOL1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SGOL1
Entrez GeneID
151648GeneBank Accession#
BC017867Protein Accession#
AAH17867Gene Name
SGOL1
Gene Alias
NY-BR-85, SGO, Sgo1
Gene Description
shugoshin-like 1 (S. pombe)
Omim ID
609168Gene Ontology
HyperlinkOther Designations
shugoshin 1AB protein|shugoshin 1CD protein|shugoshin 1EF protein|shugoshin 1GH protein|shugoshin 1KL protein|shugoshin-like 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com