YAP1 monoclonal antibody (M01), clone 2F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant YAP1.
Immunogen
YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
YAP1 monoclonal antibody (M01), clone 2F12. Western Blot analysis of YAP1 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of YAP1 expression in transfected 293T cell line by YAP1 monoclonal antibody (M01), clone 2F12.
Lane 1: YAP1 transfected lysate (Predicted MW: 54.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to YAP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to YAP1 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — YAP1
Entrez GeneID
10413GeneBank Accession#
NM_006106Protein Accession#
NP_006097Gene Name
YAP1
Gene Alias
YAP, YAP2, YAP65, YKI
Gene Description
Yes-associated protein 1, 65kDa
Omim ID
606608Gene Ontology
HyperlinkGene Summary
This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [provided by RefSeq
Other Designations
yes-associated protein 2
-
Interactomes
-
Diseases
-
Publication Reference
-
Primary Cutaneous NUT Carcinoma: Clinicopathologic and Genetic Study of 4 Cases.
Keisuke Goto, Yoji Kukita, Tsunekazu Hishima, Shigeto Matsushita, Takuji Tsuyuki, Kosuke Makihara, Kaori Koga, Shoko Mukumoto, Keiichiro Honma.
Am J Surg Pathol. 2024 May; Epub:0.
Application:IHC, Human, NUT carcinoma.
-
Strategic Approach to Heterogeneity Analysis of Cutaneous Adnexal Carcinomas Using Computational Pathology and Genomics.
Yuuki Nishimura, Eijitsu Ryo, Satoshi Inoue, Masahito Kawazu, Toshihide Ueno, Kenjiro Namikawa, Akira Takahashi, Dai Ogata, Akihiko Yoshida, Naoya Yamazaki, Hiroyuki Mano, Yasushi Yatabe, Taisuke Mori.
JID Innovations 2023 Sep; 3(6):100229.
Application:IHC, Human, Porocarcinoma.
-
Yes-associated protein regulates cortical actin architecture and dynamics through intracellular translocation of Rho GTPase-activating protein 18.
Yanshu Zhang, Takao Kitagawa, Makoto Furutani-Seiki, Shige H Yoshimura.
FASEB Journal 2023 Sep; 37(9):e23161.
Application:WB, Dog, MDCK (NBL-2) cells.
-
The biophysical property of the limbal niche maintains stemness through YAP.
Swarnabh Bhattacharya, Abhishek Mukherjee, Sabrina Pisano, Shalini Dimri, Eman Knaane, Anna Altshuler, Waseem Nasser, Sunanda Dey, Lidan Shi, Ido Mizrahi, Noam Blum, Ophir Jokel, Aya Amitai-Lange, Anna Kaganovsky, Michael Mimouni, Sergiu Socea, Mohamad Midlij, Beatrice Tiosano, Peleg Hasson, Chloe Feral, Haguy Wolfenson, Ruby Shalom-Feuerstein.
Cell Death and Differentiation 2023 Jun; 30(6):1601.
Application:IF, IHC, Human, Mouse, Coneal tissue, Primary human limbal epitheial cells.
-
A conserved role of the Hippo signalling pathway in initiation of the first lineage specification event across mammals.
Claudia Gerri, Afshan McCarthy, Gwen Mei Scott, Marius Regin, Panagiotis Stamatiadis, Sophie Brumm, Claire S Simon, Janet Lee, Cristina Montesinos, Caroline Hassitt, Sarah Hockenhull, Daniel Hampshire, Kay Elder, Phil Snell, Leila Christie, Ali A Fouladi-Nashta, Hilde Van de Velde, Kathy K Niakan.
Development 2023 Apr; 150(8):dev201112.
Application:IF, Cow, Human, Mouse, Rat, Cow, human, Mouse, Rat embryos.
-
Hypoxia-induced YAP activation and focal adhesion turnover to promote cell migration in mesenchymal TNBC cells.
Thi My Hang Nguyen, Yi-Shyun Lai, Ying-Chi Chen, Tzu-Chien Lin, Ngoc Thang Nguyen, Wen-Tai Chiu.
Cancer Medicine 2023 Feb; [Epub].
Application:IF, Human, BT-549, HCC 1806, Hs 578T, MCF7, MCF10A, MDA-MB-231, MDA-MB-468 cells.
-
Seborrheic Keratosis With Malignant Transformation (Invasive or Noninvasive Squamous Cell Carcinoma Arising in Seborrheic Keratosis): A Clinicopathologic and Immunohistochemical Study of 11 Cases.
Keisuke Goto, Kohei Ogawa, Tsunekazu Hishima, Naoki Oishi, Ozumi Tomita, Takuji Tsuyuki, Takao Oda, Yoshifumi Iwahashi, Yutaka Inaba, Keiichiro Honma.
The American Journal of Dermatopathology 2022 Dec; 44(12):891.
Application:IF, Human, Human seborrheic keratosis.
-
Nucleotide- and Protein-Dependent Functions of Actg1.
Lauren J. Sundby, William M. Southern, Katelin M. Hawbaker, Jesús M. Trujillo, Benjamin J. Perrin, and James M. Ervasti.
Molecular Biology of the Cell 2022 Aug; 33(9):ar77.
Application:WB-Ce, Mouse, MEF cells.
-
HDAC11 activity contributes to MEK inhibitor escape in uveal melanoma.
Sathya Neelature Sriramareddy, Fernanda Faião-Flores, Michael F Emmons, Biswarup Saha, Srikumar Chellappan, Clayton Wyatt, Inna Smalley, Jonathan D Licht, Michael A Durante, J William Harbour, Keiran S M Smalley.
Cancer Gene Therapy 2022 Dec; 29(12):1840.
Application:WB, Human, Mel270 cells.
-
Relationship of matrix stiffness and cell morphology in regulation of osteogenesis and adipogenesis of BMSCs.
Yutong Guo, Yini Qiao, Shuqi Quan, Cai Yang, Juan Li.
Molecular Biology Reports 2022 Apr; 49(4):2677.
Application:IF, Rat, Rat bone mesenchymal stem cells.
-
Increased ACTL6A occupancy within mSWI/SNF chromatin remodelers drives human squamous cell carcinoma.
Chiung-Ying Chang, Zohar Shipony, Sherry G Lin, Ann Kuo, Xiaochen Xiong, Kyle M Loh, William J Greenleaf, Gerald R Crabtree.
Molecular Cell 2021 Dec; 81(24):4964.
Application:WB-Ce, Human, FaDu cells, Primary human keratinocytes .
-
The RGS-RhoGEFs control the amplitude of YAP1 activation by serum.
Brandon S Lane, Brigitte Heller, Morley D Hollenberg, Clark D Wells.
Scientific Reports 2021 Jan; 11(1):2348.
Application:WB-Tr, Human, MCF-7 cells.
-
Phosphorylation and dephosphorylation of Ser852 and Ser889 control the clustering, localization and function of PAR3.
Kazunari Yamashita, Keiko Mizuno, Kana Furukawa, Hiroko Hirose, Natsuki Sakurai, Maki Masuda-Hirata, Yoshiko Amano, Tomonori Hirose, Atsushi Suzuki, Shigeo Ohno.
Journal of Cell Science 2020 Nov; 133(22):jcs244830.
Application:WB-Tr, Human, HEK 293T cells.
-
A case of YAP1 and NUTM1 rearranged porocarcinoma with corresponding immunohistochemical expression: Review of recent advances in poroma and porocarcinoma pathogenesis with potential diagnostic utility.
Ourania Parra, Darcy A Kerr, Julia A Bridge, Andrew P Loehrer, Konstantinos Linos.
Journal of Cutaneous Pathology 2021 Jan; 48(1):95.
Application:IHC-P, Human, Human cutaneous neoplasms, Human poroma and porocarcinoma.
-
Engineering Slit-Like Channels for Studying the Growth of Epithelial Tissues in 3D-confined Spaces.
Laura Alaimo, Marine Luciano, Danahe Mohammed, Marie Versaevel, Céline Bruyère, Eléonore Vercruysse, Sylvain Gabriele.
Biotechnology and Bioengineering 2020 Sep; 117(9):2887.
Application:IF, Dog, Epithelial tissues, MDCK cells.
-
Glycolysis-Independent Glucose Metabolism Distinguishes TE from ICM Fate during Mammalian Embryogenesis.
Chi F, Sharpley MS, Nagaraj R, Roy SS, Banerjee U.
Developmental Cell 2020 Apr; 53(1):9.
Application:IF, Mouse, Embryos.
-
Novel HDAC11 inhibitors suppress lung adenocarcinoma stem cell self-renewal and overcome drug resistance by suppressing Sox2.
Bora-Singhal N, Mohankumar D, Saha B, Colin CM, Lee JY, Martin MW, Zheng X, Coppola D, Chellappan S.
Scientific Reports 2020 Mar; 10(1):4722.
Application:WB-Ce, WB-Tr, Human, A-549, AALE, H358, H460, H1650, HCC827, Lung fibroblasts, PC9.
-
Effect of Downregulating the Hippo Pathway Members YAP1 and LATS2 Transcripts on Early Development and Gene Expression Involved in Differentiation in Porcine Embryos.
Emura N, Saito Y, Miura R, Sawai K.
Cell Reports 2020 Apr; 22(2):62.
Application:IF, Pig, Embryos, Oocytes.
-
Osmotic Gradients in Epithelial Acini Increase Mechanical Tension across E-cadherin, Drive Morphogenesis, and Maintain Homeostasis.
Narayanan V, Schappell LE, Mayer CR, Duke AA, Armiger TJ, Arsenovic PT, Mohan A, Dahl KN, Gleghorn JP, Conway DE.
Current Biology : CB 2020 Feb; 30(4):624.
Application:IF, Dog, MDCK-2 cells.
-
Actomyosin contractility scales with myoblast elongation and enhances differentiation through YAP nuclear export.
Bruyère C, Versaevel M, Mohammed D, Alaimo L, Luciano M, Vercruysse E, Gabriele S.
Scientific Reports 2019 Oct; 9(1):15565.
Application:IF, WB-Ce, Mouse, C2C12 cells.
-
BCR-ABL induces tyrosine phosphorylation of YAP leading to expression of Survivin and Cyclin D1 in chronic myeloid leukemia cells.
Moriyama K, Hori T.
International Journal of Hematology 2019 Nov; 110(5):591.
Application:WB-Ce, Human, TCC-S, K-562, HL-60, KG-1a cells.
-
Identification of a novel embryo-prevalent gene, Gm11545, involved in preimplantation embryogenesis in mice.
Kim J, Kim J, Jeong J, Hong SH, Kim D, Choi S, Choi I, Oh JS, Cho C.
FASEB Journal 2019 Oct; 33(10):11326.
Application:IF, Mouse, Mouse embryos.
-
Akt plays indispensable roles during the first cell lineage differentiation of mouse.
Xu S, Pang L, Liu Y, Lian X, Mo K, Lv R, Zhu H, Lv C, Lin J, Sun J, Xu L, Wang S.
Journal of Molecular Histology 2019 Aug; 50(4):369.
Application:IF, Mouse, Mouse blastocysts.
-
Regulation of Sox2 and stemness by nicotine and electronic-cigarettes in non-small cell lung cancer.
Schaal CM, Bora-Singhal N, Kumar DM, Chellappan SP.
Molecular Cancer 2018 Oct; 17(1):149.
Application:WB-Tr, Human, A-549 cells.
-
The Epithelial Circumferential Actin Belt Regulates YAP/TAZ through Nucleocytoplasmic Shuttling of Merlin.
Furukawa KT, Yamashita K, Sakurai N, Ohno S.
Cell Reports 2017 Aug; 20(6):1435.
Application:WB, Dog, MDCK (NBL-2).
-
Common and Distinctive Functions of the Hippo Effectors Taz and Yap in Skeletal Muscle Stem Cell Function.
Sun C, De Mello V, Mohamed A, Ortuste Quiroga HP, Garcia-Munoz A, Al Bloshi A, Tremblay AM, von Kriegsheim A, Collie-Duguid E, Vargesson N, Matallanas D, Wackerhage H, Zammit PS.
Stem Cells 2017 Jun; 35(8):1958.
Application:IF, WB, Mouse, C2C12 cells.
-
Yap/Taz transcriptional activity is essential for vascular regression via Ctgf expression and actin polymerization.
Nagasawa-Masuda A, Terai K.
Amino Acids 2017 Apr; 12(4):e0174633.
Application:IHC, Mouse, Mouse ductus arteriosus.
-
The Apical Domain Is Required and Sufficient for the First Lineage Segregation in the Mouse Embryo.
Korotkevich E, Niwayama R, Courtois A, Friese S, Berger N, Buchholz F, Hiiragi T.
Developmental Cell 2017 Feb; 40(3):235.
Application:IF, Mouse, Mouse Embryos.
-
Overexpression of TEAD4 in atypical teratoid/rhabdoid tumor: New insight to the pathophysiology of an aggressive brain tumor.
Suzuki M, Kondo A, Ogino I, Arai H, Tomita T, Sredni ST.
Pediatric Blood & Cancer. 2016 Dec; 64(7).
Application:IHC-P, Human, Human Atypical teratoid/rhabdoid tumor (AT/RT).
-
Toxin A of the nosocomial pathogen Clostridium difficile induces primary effects in the proteome of HEp‐2 cells.
Junemann J, Birgin G, Erdmann J, Schröder A, Just I, Gerhard R, Pich A.
Proteomics. Clinical Applications 2017 Mar; 11(3-4).
Application:WB, Human, HEp-2 cells.
-
Asymmetric division of contractile domains couples cell positioning and fate specification.
Maître JL, Turlier H, Illukkumbura R, Eismann B, Niwayama R, Nédélec F, Hiiragi T.
Nature 2016 Aug; 536(7616):344.
Application:IF, Mouse, Mouse embryo.
-
Multiple Mechanisms Cooperate to Constitutively Exclude the Transcriptional Co-Activator YAP from the Nucleus During Murine Oogenesis.
Abbassi L, Malki S, Cockburn K, Macaulay A, Robert C, Rossant J, Clarke HJ.
Biology of Reproduction 2016 May; 94(5:102.
Application:IF, Mouse, Oocytes, Granulosa-oocyte complexes, Cumulus-oocyte complexes.
-
Early preimplantation cells expressing Cdx2 exhibit plasticity of specification to TE and ICM lineages through positional changes.
Yoyooka Y, Oka S, Fujimori T.
Developmental Biology 2016 Mar; 411(1):50.
Application:IF, Mouse, Embryo.
-
Par-aPKC-dependent and -independent mechanisms cooperatively control cell polarity, Hippo signaling, and cell positioning in 16-cell stage mouse embryos.
Hirate Y, Hirahara S, Inoue K, Kiyonari H, Niwa H, Sasaki H.
Development, Growth & Differentiation 2015 Oct; 57(8):544.
Application:IF, Mouse, Embryos.
-
Oncoprotein YAP Regulates the Spindle Checkpoint Activation in a Mitotic Phosphorylation-dependent Manner through Upregulation of BubR1.
Yang S, Zhang L, Chen X, Chen Y, Dong J.
The Journal of Biological Chemistry 2015 Mar; 290(10):2020.
Application:IP-WB, WB-Ce, WB-Tr, Human, HeLa, MCF-7, HPNE cells .
-
Yap tunes airway epithelial size and architecture by regulating the identity, maintenance, and self-renewal of stem cells.
Rui Zhao, Timothy R Fallon, Srinivas Vinod Saladi, Ana Pardo-Saganta, Jorge Villoria, Hongmei Mou, Vladimir Vinarsky, Meryem Gonzalez-Celeiro, Naveen Nunna, Lida P Hariri, Fernando Camargo, Leif W Ellisen, Jayaraj Rajagopal.
Developmental Cell 2014 Jul; 30(2):151.
Application:IHC, WB, Human, Mouse, Human basal stem cells, Mouse trachea.
-
A functional interaction between Hippo-YAP signalling and FoxO1 mediates the oxidative stress response.
Shao D, Zhai P, Del Re DP, Sciarretta S, Yabuta N, Nojima H, Lim DS, Pan D, Sadoshima J.
Nature Communications 2014 Feb; 5:3315.
Application:Immunocytochemistry, Mouse, Neonatal cardiomyocytes.
-
CDK1 phosphorylation of YAP promotes mitotic defects and cell motility and is essential forneoplastic transformation.
Yang S, Zhang L, Liu M, Chong R, Ding SJ, Chen Y, Dong J.
Cancer Research 2013 Nov; 73(22):6722.
Application:IP, Human, HeLa cells.
-
Stromal-epithelial crosstalk regulates kidney progenitor cell differentiation.
Das A, Tanigawa S, Karner CM, Xin M, Lum L, Chen C, Olson EN, Perantoni AO, Carroll TJ.
Nature Cell Biology 2013 Sep; 15(9):1035.
Application:WB, Mouse, Mouse metanephric mesenchyme cells.
-
Serum deprivation inhibits the transcriptional co-activator YAP and cell growth via phosphorylation of the 130-kDa isoform of Angiomotin by the LATS1/2 protein kinases.
Adler JJ, Johnson DE, Heller BL, Bringman LR, Ranahan WP, Conwell MD, Sun Y, Hudmon A, Wells CD.
PNAS 2013 Oct; 110(43):17368.
Application:WB, Human, HEK 293T cells.
-
Amot130 Adapts Atrophin-1 Interacting Protein 4 to Inhibit Yes-associated Protein Signaling and Cell Growth.
Adler JJ, Heller BL, Bringman LR, Ranahan WP, Cocklin RR, Goebl MG, Oh M, Lim HS, Ingham RJ, Wells CD.
The Journal of Biological Chemistry 2013 May; 288(21):15181.
Application:WB, Human, MDA-MB-468 cells.
-
Tead4 is constitutively nuclear, while nuclear vs. cytoplasmic Yap distribution is regulated in preimplantation mouse embryos.
Hirate Y, Cockburn K, Rossant J, Sasaki H.
PNAS 2012 Dec; 109(50):E3389.
Application:IF, Mouse, Embryos.
-
YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation.
Skouloudaki K, Walz G.
PLoS One 2012 Apr; 7(4):e35735.
Application:WB, Human, HEK 293T cells.
-
Hippo pathway regulation by cell morphology and stress fibers.
Wada K, Itoga K, Okano T, Yonemura S, Sasaki H.
Development 2011 Sep; 138(18):3907.
Application:IF, Mouse, NIH/3T3 cells.
-
Inactivation of Merlin in malignant mesothelioma cells and the Hippo signaling cascade dysregulation.
Sekido Y.
Pathology International 2011 Jun; 61(6):331.
Application:ICC, Human, Malignant mesothelioma cells.
-
Identification of miR-193b targets in breast cancer cells and systems biological analysis of their functional impact.
Leivonen SK, Rokka A, Ostling P, Kohonen P, Corthals GL, Kallioniemi O, Perala M.
Molecular & Cellular Proteomics 2011 Jul; 10(7):M110.00532.
Application:WB, Human, MCF-7 cells.
-
LATS2 Is a Tumor Suppressor Gene of Malignant Mesothelioma.
Murakami H, Mizuno T, Taniguchi T, Fujii M, Ishiguro F, Fukui T, Akatsuka S, Horio Y, Hida T, Kondo Y, Toyokuni S, Osada H, Sekido Y.
Cancer Research 2011 Feb; 71(3):873.
Application:WB-Ce, Human, Malignant mesothelioma, Met-5A, NCI-H290, Y-MESO-14, Y-MESO-27, Y-MESO-30 cells.
-
JNK phosphorylates Yes-associated protein (YAP) to regulate apoptosis.
V Tomlinson, K Gudmundsdottir, P Luong, K-Y Leung, A Knebel, S Basu.
Cell Death & Disease 2010 Jan; 1:e29.
Application:IP, WB-Tr, Human, HaCaT, HEK 293T, MCF-7, U-2 OS cells.
-
Merlin Is a Potent Inhibitor of Glioma Growth.
Lau YK, Murray LB, Houshmandi SS, Xu Y, Gutmann DH, Yu Q.
Cancer Research 2008 Jul; 68(14):5733.
Application:WB, Human, U87MG cells.
-
Primary Cutaneous NUT Carcinoma: Clinicopathologic and Genetic Study of 4 Cases.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com