ELA3A MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ELA3A protein.
Immunogen
ELA3A (NP_005738.3, 1 a.a. ~ 270 a.a) full-length human protein.
Sequence
MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ELA3A MaxPab rabbit polyclonal antibody. Western Blot analysis of ELA3A expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of ELA3A expression in transfected 293T cell line (H00010136-T02) by ELA3A MaxPab polyclonal antibody.
Lane 1: ELA3A transfected lysate(29.50 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ELA3A transfected lysate using anti-ELA3A MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ELA3A purified MaxPab mouse polyclonal antibody (B01P) (H00010136-B01P). -
Gene Info — ELA3A
Entrez GeneID
10136GeneBank Accession#
NM_005747.3Protein Accession#
NP_005738.3Gene Name
ELA3A
Gene Alias
ELA3
Gene Description
elastase 3A, pancreatic
Gene Ontology
HyperlinkGene Summary
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1. [provided by RefSeq
Other Designations
OTTHUMP00000002835|elastase 1|protease E
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com