AKAP7 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of AKAP7 expression in transfected 293T cell line (H00009465-T02) by AKAP7 MaxPab polyclonal antibody.
Lane 1: AKAP7 transfected lysate(11.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human AKAP7 protein.
Immunogen
AKAP7 (NP_619539.1, 1 a.a. ~ 104 a.a) full-length human protein.
Sequence
MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AKAP7 expression in transfected 293T cell line (H00009465-T02) by AKAP7 MaxPab polyclonal antibody.
Lane 1: AKAP7 transfected lysate(11.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AKAP7
Entrez GeneID
9465GeneBank Accession#
NM_138633Protein Accession#
NP_619539.1Gene Name
AKAP7
Gene Alias
AKAP18
Gene Description
A kinase (PRKA) anchor protein 7
Omim ID
604693Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined. [provided by RefSeq
Other Designations
A-kinase anchor protein 7|A-kinase anchor protein 7 isoform alpha|A-kinase anchor protein 7, isoform alpha|A-kinase anchor protein 9 kDa|A-kinase anchor protein, 18-kD|A-kinase anchoring protein 18|OTTHUMP00000017200|OTTHUMP00000017201|OTTHUMP00000017202|
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com