ADAM9 monoclonal antibody (M01), clone 3E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADAM9.
Immunogen
ADAM9 (NP_003807, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (78)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ADAM9 monoclonal antibody (M01), clone 3E6 Western Blot analysis of ADAM9 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADAM9 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — ADAM9
Entrez GeneID
8754GeneBank Accession#
NM_003816Protein Accession#
NP_003807Gene Name
ADAM9
Gene Alias
KIAA0021, MCMP, MDC9, Mltng
Gene Description
ADAM metallopeptidase domain 9 (meltrin gamma)
Omim ID
602713Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Two alternative splice variants have been identified, encoding distinct isoforms. [provided by RefSeq
Other Designations
ADAM metallopeptidase domain 9|a disintegrin and metalloproteinase domain 9 (meltrin gamma)|cellular disintegrin-related protein|meltrin gamma|myeloma cell metalloproteinase
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com