Product Browser

Last updated: 2014/8/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDK2AP1 (Human) Recombinant Protein (P01)

  • Catalog # : H00008099-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDK2AP1 full-length ORF ( AAH34717, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.39
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008099-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8099
  • Gene Name:
  • CDK2AP1
  • Gene Alias:
  • DOC1,DORC1,ST19,doc-1,p12DOC-1
  • Gene Description:
  • cyclin-dependent kinase 2 associated protein 1
  • Gene Summary:
  • The protein encoded by this gene is a specific CDK2-associated protein, which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggested the regulatory role in DNA replication during S phase of the cell cycle. A similar gene in hamster was isolated from, and functions as a growth suppressor of normal keratinocytes. [provided by RefSeq
  • Other Designations:
  • CDK2-associated protein 1,CDK2-associated protein 1,Deleted in oral cancer-1,cyclin-dependent kinase 2-associated protein 1,putative oral cancer suppressor
  • RSS
  • YouTube
  • Linkedin
  • Facebook