Product Browser

Last updated: 2014/11/16
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VEGF (Human) Recombinant Protein (Q01)

  • Catalog # : H00007422-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human VEGF partial ORF ( NP_003367, 27 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.18
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007422-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7422
  • Gene Name:
  • VEGFA
  • Gene Alias:
  • MGC70609,VEGF,VEGF-A,VPF
  • Gene Description:
  • vascular endothelial growth factor A
  • Gene Summary:
  • This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq
  • Other Designations:
  • vascular endothelial growth factor isoform VEGF165,vascular permeability factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook