Product Browser

Last updated: 2014/9/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LEFTY2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00007044-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human LEFTY2 protein.
  • Immunogen:
  • LEFTY2 (NP_003231.2, 1 a.a. ~ 366 a.a) full-length human protein.
  • Sequence:
  • MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LEFTY2 expression in transfected 293T cell line (H00007044-T01) by LEFTY2 MaxPab polyclonal antibody.

    Lane 1: LEFTY2 transfected lysate(40.90 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 7044
  • Gene Name:
  • LEFTY2
  • Gene Alias:
  • EBAF,LEFTA,LEFTYA,MGC46222,TGFB4
  • Gene Description:
  • left-right determination factor 2
  • Gene Summary:
  • This gene encodes a member of the TGF-beta family of proteins. The encoded protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000035570,endometrial bleeding associated factor,endometrial bleeding associated factor (left-right determination, factor A; transforming growth factor beta superfamily),transforming growth factor, beta-4 (endometrial bleeding-associated factor;
  • RSS
  • YouTube
  • Linkedin
  • Facebook