S100A10 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human S100A10 protein.
Immunogen
S100A10 (AAH15973, 1 a.a. ~ 97 a.a) full-length human protein.
Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
S100A10 MaxPab polyclonal antibody. Western Blot analysis of S100A10 expression in human lung cancer.Western Blot (Transfected lysate)
Western Blot analysis of S100A10 expression in transfected 293T cell line (H00006281-T01) by S100A10 MaxPab polyclonal antibody.
Lane1:S100A10 transfected lysate(10.78 KDa).
Lane 2:Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to S100A10 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — S100A10
Entrez GeneID
6281GeneBank Accession#
BC015973Protein Accession#
AAH15973Gene Name
S100A10
Gene Alias
42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, MGC111133, P11, p10
Gene Description
S100 calcium binding protein A10
Omim ID
114085Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq
Other Designations
OTTHUMP00000015269|OTTHUMP00000015270|S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))|S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))|annexin II ligand, calpactin I, lig
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com