RFC3 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human RFC3 protein.
Immunogen
RFC3 (NP_002906.1, 1 a.a. ~ 356 a.a) full-length human protein.
Sequence
MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RFC3 MaxPab polyclonal antibody. Western Blot analysis of RFC3 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of RFC3 expression in transfected 293T cell line (H00005983-T02) by RFC3 MaxPab polyclonal antibody.
Lane 1: RFC3 transfected lysate(40.60 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RFC3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RFC3
Entrez GeneID
5983GeneBank Accession#
NM_002915Protein Accession#
NP_002906.1Gene Name
RFC3
Gene Alias
MGC5276, RFC38
Gene Description
replication factor C (activator 1) 3, 38kDa
Omim ID
600405Gene Ontology
HyperlinkGene Summary
The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. This gene encodes the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
A1 38 kDa subunit|OTTHUMP00000018237|RFC, 38 kD subunit|replication factor C (activator 1) 3 (38kD)|replication factor C 3
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com