Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Biomarker
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

POU5F1 monoclonal antibody (M01), clone 1D2   

  • Catalog # : H00005460-M01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant POU5F1.
  • Immunogen:
  • POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005460-M01
    Western Blot detection against Immunogen (35.24 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • POU5F1 monoclonal antibody (M01), clone 1D2. Western Blot analysis of POU5F1 expression in MCF-7.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody (M01), clone 1D2.

    Lane 1: POU5F1 transfected lysate(18.3 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5460
  • Gene Name:
  • POU5F1
  • Gene Alias:
  • MGC22487,OCT3,OCT4,OTF3,OTF4
  • Gene Description:
  • POU class 5 homeobox 1
  • Other Designations:
  • OTTHUMP00000029292,POU domain, class 5, transcription factor 1,POU-type homeodomain-containing DNA-binding protein,octamer-binding transcription factor-3
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!