PF4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PF4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PF4 expression in human spleen.
Western Blot (Cell lysate)
PF4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PF4 expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of PF4 expression in transfected 293T cell line (H00005196-T02) by PF4 MaxPab polyclonal antibody.
Lane 1: PF4 transfected lysate(10.80 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PF4 protein.
Immunogen
PF4 (NP_002610.1, 1 a.a. ~ 101 a.a) full-length human protein.
Sequence
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PF4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PF4 expression in human spleen.Western Blot (Cell lysate)
PF4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PF4 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of PF4 expression in transfected 293T cell line (H00005196-T02) by PF4 MaxPab polyclonal antibody.
Lane 1: PF4 transfected lysate(10.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PF4
Entrez GeneID
5196GeneBank Accession#
NM_002619Protein Accession#
NP_002610.1Gene Name
PF4
Gene Alias
CXCL4, MGC138298, SCYB4
Gene Description
platelet factor 4
Omim ID
173460Gene Ontology
HyperlinkGene Summary
Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM
Other Designations
chemokine (C-X-C motif) ligand 4|platelet factor 4 (chemokine (C-X-C motif) ligand 4)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com