ENPP3 monoclonal antibody (M01), clone 1G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ENPP3 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ENPP3.
Immunogen
ENPP3 (NP_005012, 602 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ENPP3 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — ENPP3
Entrez GeneID
5169GeneBank Accession#
NM_005021Protein Accession#
NP_005012Gene Name
ENPP3
Gene Alias
B10, CD203c, NPP3, PD-IBETA, PDNP3
Gene Description
ectonucleotide pyrophosphatase/phosphodiesterase 3
Omim ID
602182Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to a series of ectoenzymes that are involved in hydrolysis of extracellular nucleotides. These ectoenzymes possess ATPase and ATP pyrophosphatase activities and are type II transmembrane proteins. Expression of the related rat mRNA has been found in a subset of immature glial cells and in the alimentary tract. The corresponding rat protein has been detected in the pancreas, small intestine, colon, and liver. The human mRNA is expressed in glioma cells, prostate, and uterus. Expression of the human protein has been detected in uterus, basophils, and mast cells. [provided by RefSeq
Other Designations
OTTHUMP00000040272|dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)|dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)|gp130RB13-6|phosphodiesterase I/nucleotide pyrophosphatase 3|phosphodiesterase-I beta
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com