MYH9 monoclonal antibody (M01), clone 3C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MYH9 monoclonal antibody (M01), clone 3C7. Western Blot analysis of MYH9 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
MYH9 monoclonal antibody (M01), clone 3C7 Western Blot analysis of MYH9 expression in A-431 ( Cat # L015V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYH9 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to MYH9 on A-431 cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MYH9.
Immunogen
MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (94)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MYH9 monoclonal antibody (M01), clone 3C7. Western Blot analysis of MYH9 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
MYH9 monoclonal antibody (M01), clone 3C7 Western Blot analysis of MYH9 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYH9 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MYH9 on A-431 cell . [antibody concentration 10 ug/ml] -
Gene Info — MYH9
Entrez GeneID
4627GeneBank Accession#
NM_002473.5Protein Accession#
NP_002464.1Gene Name
MYH9
Gene Alias
DFNA17, EPSTS, FTNS, MGC104539, MHA, NMHC-II-A, NMMHCA
Gene Description
myosin, heavy chain 9, non-muscle
Gene Ontology
HyperlinkGene Summary
This gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq
Other Designations
MYH9 variant protein|OTTHUMP00000028706|cellular myosin heavy chain, type A|myosin, heavy polypeptide 9, non-muscle|non-muscle myosin heavy chain|non-muscle myosin heavy polypeptide 9|nonmuscle myosin heavy chain II-A
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
An ex vivo culture model of kidney podocyte injury reveals mechanosensitive, synaptopodin-templating, sarcomere-like structures.
Shumeng Jiang, Farid Alisafaei, Yin-Yuan Huang, Yuan Hong, Xiangjun Peng, Chengqing Qu, Pongpratch Puapatanakul, Sanjay Jain, Jeffrey H Miner, Guy M Genin, Hani Y Suleiman.
Science Advances 2022 Sep; 8(35):eabn6027.
Application：IF, Mouse , Mouse podocyte.
-
Synaptopodin deficiency exacerbates kidney disease in a mouse model of Alport Syndrome.
Liang Ning, Hani Y Suleiman, Jeffrey H Miner.
American Journal of Physiology. Renal Physiology 2021 Jul; 321(1):F12.
Application：IF, IHC-Fr, Mouse, Mouse kidney.
-
Synaptopodin Is Dispensable for Normal Podocyte Homeostasis but Is Protective in the Context of Acute Podocyte Injury.
Liang Ning, Hani Y Suleiman, Jeffrey H Miner.
Journal of the American Society of Nephrology 2020 Dec; 31(12):2815.
Application：IF, IHC-Fr, Mouse, Mouse glomeruli, Mouse kidney.
-
F-Actin Interactome Reveals Vimentin as a Key Regulator of Actin Organization and Cell Mechanics in Mitosis.
Serres MP, Samwer M, Truong Quang BA, Lavoie G, Perera U, Görlich D, Charras G, Petronczki M, Roux PP, Paluch EK.
Developmental Cell 2020 Jan; 52(2):210.
Application：WB-Ce, Human, HeLa cells.
-
Ripor2 is involved in auditory hair cell stereociliary bundle structure and orientation.
Diaz-Horta O, Abad C, Cengiz FB, Bademci G, Blackwelder P, Walz K, Tekin M.
Journal of Molecular Medicine (Berlin, Germany) 2018 Nov; 96(11):1227.
Application：IF, IHC, WB, Mouse, Mouse hair cells.
-
Injury-induced actin cytoskeleton reorganization in podocytes revealed by super-resolution microscopy.
Suleiman HY, Roth R, Jain S, Heuser JE, Shaw AS, Miner JH.
JCI Insight 2017 Aug; 2(16):94137.
Application：IF, IHC-Fr, Human, Mouse, Human and mouse glomeruli.
-
An ex vivo culture model of kidney podocyte injury reveals mechanosensitive, synaptopodin-templating, sarcomere-like structures.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com