- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25895)
- MaxPab® Ab (16205)
- Monoclonal Ab (21428)
- Polyclonal Ab (27861)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7710)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2004)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2136)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (18054)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > MaxPab® Ab > Human > Binding > Others > KRT82 purified MaxPab mouse polyclonal antibody (B01P)
KRT82 purified MaxPab mouse polyclonal antibody (B01P) 
- Catalog # : H00003888-B01P
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 50 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse polyclonal antibody raised against a full-length human KRT82 protein.
- Immunogen:
- KRT82 (AAI53100.1, 1 a.a. ~ 513 a.a) full-length human protein.
- Sequence:
- MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNVGFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAGGSSPSHKH
- Host:
- Mouse
- Reactivity:
- Human
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
- Western Blot (Transfected lysate)
- Western Blot analysis of KRT82 expression in transfected 293T cell line (H00003888-T01) by KRT82 MaxPab polyclonal antibody.
Lane 1: KRT82 transfected lysate(56.43 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Entrez GeneID:
- 3888
- GeneBank Accession#:
- BC153099.1
- Protein Accession#:
- AAI53100.1
- Gene Name:
- KRT82
- Gene Alias:
- HB2,Hb-2,KRTHB2
- Gene Description:
- keratin 82
- Omim ID:
- 601078
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this keratin appears to be a hair cuticle-specific keratin. [provided by RefSeq
- Other Designations:
- hard keratin, type II, 2,keratin, hair, basic, 2
