CDC42 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CDC42 protein.
Immunogen
CDC42 (NP_001782.1, 1 a.a. ~ 191 a.a) full-length human protein.
Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDC42 expression in transfected 293T cell line (H00000998-T02) by CDC42 MaxPab polyclonal antibody.
Lane 1: CDC42 transfected lysate(21.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDC42 and MAPK8. HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-MAPK8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CDC42
Entrez GeneID
998GeneBank Accession#
NM_001791Protein Accession#
NP_001782.1Gene Name
CDC42
Gene Alias
CDC42Hs, G25K
Gene Description
cell division cycle 42 (GTP binding protein, 25kDa)
Omim ID
116952Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
Other Designations
GTP-binding protein, 25kD|OTTHUMP00000002834|OTTHUMP00000002926|cell division cycle 42|cell division cycle 42 (GTP binding protein, 25kD)|cell division cycle 42 (GTP-binding protein, 25kD)|dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))|d
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com