CCNB1 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00000891-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of CCNB1 expression in transfected 293T cell line (H00000891-T01) by CCNB1 MaxPab polyclonal antibody.

Lane 1: CCNB1 transfected lysate(48.30 KDa).
Lane 2: Non-transfected lysate.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between CCNB1 and CDC25A. Mahlavu cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-CDC25A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between CCNB1 and PKMYT1. Huh7 cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-PKMYT1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between CCNB1 and CDKN1A. HeLa cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-CDKN1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human CCNB1 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    CCNB1 (NP_114172.1, 1 a.a. ~ 433 a.a) full-length human protein.

    Sequence

    MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

    Host

    Rabbit

    Reactivity

    Human

    Interspecies Antigen Sequence

    Rat (85)

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of CCNB1 expression in transfected 293T cell line (H00000891-T01) by CCNB1 MaxPab polyclonal antibody.

    Lane 1: CCNB1 transfected lysate(48.30 KDa).
    Lane 2: Non-transfected lysate.

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between CCNB1 and CDC25A. Mahlavu cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-CDC25A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between CCNB1 and PKMYT1. Huh7 cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-PKMYT1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between CCNB1 and CDKN1A. HeLa cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-CDKN1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — CCNB1

    Entrez GeneID

    891

    GeneBank Accession#

    NM_031966

    Protein Accession#

    NP_114172.1

    Gene Name

    CCNB1

    Gene Alias

    CCNB

    Gene Description

    cyclin B1

    Omim ID

    123836

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites. [provided by RefSeq

    Other Designations

    G2/mitotic-specific cyclin B1

  • Interactome
  • Pathway
  • Disease
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All