CTSB polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CTSB.
Immunogen
Recombinant protein corresponding to human CTSB.
Sequence
DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebellum shows moderate granular cytoplasmic positivity in neuronal cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.Immunofluorescence
Immunofluorescent staining of A-431 cell line with antibody shows positivity in nucleoli and vesicles (green). -
Gene Info — CTSB
Entrez GeneID
1508Protein Accession#
P07858Gene Name
CTSB
Gene Alias
APPS, CPSB
Gene Description
cathepsin B
Omim ID
116810Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a lysosomal cysteine proteinase composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer disease, the most common cause of dementia. Overexpression of the encoded protein, which is a member of the peptidase C1 family, has been associated with esophageal adenocarcinoma and other tumors. At least five transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
APP secretase|OTTHUMP00000116009|amyloid precursor protein secretase|cathepsin B1|cysteine protease|preprocathepsin B
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis.
Perisic L, Hedin E, Razuvaev A, Lengquist M, Osterholm C, Folkersen L, Gillgren P, Paulsson-Berne G, Ponten F, Odeberg J, Hedin U.
Arteriosclerosis, Thrombosis, and Vascular Biology 2013 Oct; 33(10):2432.
Application:IHC-P, Human, Human tissue microarray.
-
Heterogeneity in signaling pathways of gastroenteropancreatic neuroendocrine tumors: a critical look at notch signaling pathway.
Wang H, Chen Y, Fernandez-Del Castillo C, Yilmaz O, Deshpande V.
Modern Pathology 2013 Jan; 26(1):139.
Application:IHC-P, Human, Human rectal neuroendocrine tumors.
-
Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com