CDH6 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CDH6.
Immunogen
Recombinant protein corresponding to human CDH6.
Sequence
ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of EFO-21 cell lysate with CDH6 polyclonal antibody (Cat # PAB31388).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CDH6 polyclonal antibody (Cat # PAB31388) shows distinct membranous positivity in cells in tubules. -
Gene Info — CDH6
Entrez GeneID
1004Protein Accession#
P55285Gene Name
CDH6
Gene Alias
KCAD
Gene Description
cadherin 6, type 2, K-cadherin (fetal kidney)
Omim ID
603007Gene Ontology
HyperlinkGene Summary
This gene encodes a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of this gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion. [provided by RefSeq
Other Designations
K-cadherin|cadherin 6, K-cadherin (fetal kidney)|cadherin 6, type 2|cadherin, fetal kidney|kidney cadherin
-
Interactome
-
Publication Reference
-
Somatic mutational landscapes of adherens junctions and their functional consequences in cutaneous melanoma development.
Praveen Kumar Korla, Chih-Chieh Chen, Daniel Esguerra Gracilla, Ming-Tsung Lai, Chih-Mei Chen, Huan Yuan Chen, Tritium Hwang, Shih-Yin Chen, Jim Jinn-Chyuan Sheu.
Theranostics 2020 Oct; 10(26):12026.
Application:IF, IHC-P, Human, Human melanoma.
-
Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas.
Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS.
Molecular & Cellular Proteomics 2010 Jun; 9(6):1100.
Application:IHC, Human, Colon, Liver, Bladder, Breast, Lung cancer.
-
Somatic mutational landscapes of adherens junctions and their functional consequences in cutaneous melanoma development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com