GSTA1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human GSTA1.
Immunogen
Recombinant protein corresponding to human GSTA1.
Sequence
GKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDY
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis of (1) human cell line RT-4 (2) human cell line U-251MG sp (3) human plasma (IgG/HSA depleted), and (4) human liver tissue.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver shows strong cytoplasmic positivity in hepatocytes. -
Gene Info — GSTA1
Entrez GeneID
2938Protein Accession#
P08263Gene Name
GSTA1
Gene Alias
GST2, GSTA1-1, GTH1, MGC131939
Gene Description
glutathione S-transferase alpha 1
Omim ID
138359Gene Ontology
HyperlinkGene Summary
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq
Other Designations
GST, class alpha, 1|GST-epsilon|OTTHUMP00000016611|S-(hydroxyalkyl)glutathione lyase A1|glutathione S-alkyltransferase A1|glutathione S-aryltransferase A1|glutathione S-transferase 2|glutathione S-transferase A1|glutathione S-transferase Ha subunit 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Quantitative and selective polymerase chain reaction analysis of highly similar human alpha-class glutathione transferases.
Larsson E, Mannervik B, Raffalli-Mathieu F.
Analytical Biochemistry 2011 May; 412(1):96.
-
Quantitative and selective polymerase chain reaction analysis of highly similar human alpha-class glutathione transferases.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com