MTA1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MTA1 polyclonal antibody (Cat # PAB30742) shows strong nuclear positivity in neuronal cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG with MTA1 polyclonal antibody (Cat # PAB30742) (Green) shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human MTA1.
Immunogen
Recombinant protein corresponding to human MTA1.
Sequence
LEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MTA1 polyclonal antibody (Cat # PAB30742) shows strong nuclear positivity in neuronal cells.Immunofluorescence
Immunofluorescent staining of U-251 MG with MTA1 polyclonal antibody (Cat # PAB30742) (Green) shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — MTA1
Entrez GeneID
9112Protein Accession#
Q13330Gene Name
MTA1
Gene Alias
-
Gene Description
metastasis associated 1
Omim ID
603526Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. [provided by RefSeq
Other Designations
metastasis associated gene 1 protein|metastasis associated protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com