ZNF3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ZNF3.
Immunogen
Recombinant protein corresponding to human ZNF3.
Sequence
SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRK
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex (A, B), human cerebellum (C) and human duodenum (D) with ZNF3 polyclonal antibody (Cat # PAB30639). A: Human cerebral cortex shows nuclear positivity in neuronal cells. B: Human cerebral cortex shows strong nuclear immunoreactivity in neurons. C: Human cerebellum shows nuclear positivity in Purkinje cells, as well as in the molecular and granular cell layers. D: Human duodenum shows strong nuclear positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of U-251 MG (A), mouse midbrain (B), mouse piriform cortex (C), mouse hypothalamus (D, E) and mouse visual cortex (F) with ZNF3 polyclonal antibody (Cat # PAB30639) (Green). A: U-251 MG shows positivity in nucleus but excluded from the nucleoli. B: Mouse midbrain shows nuclear staining in neurons of the oculomotor and red nuclei. C: Mouse piriform cortex shows nuclear staining in the neurons of layer 2. D: Mouse hypothalamus shows nuclear positivity in the neurons of medial preoptic area. E: Mouse hypothalamus shows nuclear immunoreactivity in the neurons in the arcuate nucleus. F: Mouse visual cortex shows nuclear positivity in neurons. -
Gene Info — ZNF3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com