SENP1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis with SENP1 polyclonal antibody (Cat # PAB30583).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot
Western Blot analysis with SENP1 polyclonal antibody (Cat # PAB30583).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with SENP1 polyclonal antibody (Cat # PAB30583) shows strong nuclear positivity in cells in seminiferus ducts.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SENP1 polyclonal antibody (Cat # PAB30583) shows positivity in nucleus. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human SENP1.
Immunogen
Recombinant protein corresponding to amino acids 85-204 of human SENP1.
Sequence
GDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGK
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with SENP1 polyclonal antibody (Cat # PAB30583).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Western Blot
Western Blot analysis with SENP1 polyclonal antibody (Cat # PAB30583).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG spImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with SENP1 polyclonal antibody (Cat # PAB30583) shows strong nuclear positivity in cells in seminiferus ducts.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SENP1 polyclonal antibody (Cat # PAB30583) shows positivity in nucleus. Antibody staining is shown in green. -
Gene Info — SENP1
Entrez GeneID
29843Protein Accession#
Q9P0U3Gene Name
SENP1
Gene Alias
SuPr-2
Gene Description
SUMO1/sentrin specific peptidase 1
Gene Ontology
HyperlinkGene Summary
The covalent modification of proteins by the small ubiquitin (UBB; MIM 191339)-like protein SUMO (see SUMO1, MIM 601912) is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1 (Yamaguchi et al., 2005 [PubMed 15923632]).[supplied by OMIM
Other Designations
SUMO1/sentrin specific protease 1|sentrin/SUMO-specific protease|sentrin/SUMO-specific protease 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com